PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG124800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 701aa    MW: 75390 Da    PI: 5.7673
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG124800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-212075156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         r++ +++t++q+++Le++F+++++p++++r+ LA++l+L+ +q+k+WFqNrR+++k
  Pavir.4NG124800.1.p 20 RKQYHRHTPHQIQRLEAMFKECPHPDENQRAALARELDLEPQQIKFWFQNRRTQMK 75
                         789999***********************************************998 PP

2START144.51e-452084322206
                          HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          la +a++el+++a+a+ ++W k +     e +n   + + f+  ++        +e +r+sg+v+m ++ lv  ++d++ +W+e ++   
  Pavir.4NG124800.1.p 208 LAARAMDELIRLAQAGRQLWDKGVpggapETLNVAAYDSLFAAPGGafrppdIGVEGSRDSGLVFMSAVALVDVFMDTN-KWKEFFPgiv 296
                          67899*****************99877776666655555555444489999999*************************.********** PP

                          .EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                           ka t +v++sg     + l+ m+ +l +  p+vp R+f f+Ry++q + g w+++dvS d  +++p      R+++lpSg+li ++sng
  Pavir.4NG124800.1.p 297 sKAHTGDVLMSGlggrsESLVMMYEQLHMVAPVVPtREFSFLRYCKQIEPGLWAVADVSPDALRDVP-YGMPPRSRRLPSGCLIADMSNG 385
                          *****************9***********9*************************************.56777999************** PP

                          EEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          +s+vtwveh++ +  lp ++l+r lv sg+a+ga +w+a+lqr ce+
  Pavir.4NG124800.1.p 386 YSNVTWVEHMEIEQTLPiSALYRNLVLSGAAFGAHRWLAALQRACER 432
                          *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22379IPR009057Homeodomain-like
SuperFamilySSF466894.23E-201282IPR009057Homeodomain-like
PROSITE profilePS5007117.3291777IPR001356Homeobox domain
SMARTSM003891.9E-181981IPR001356Homeobox domain
PfamPF000461.9E-182075IPR001356Homeobox domain
CDDcd000864.15E-182078No hitNo description
PROSITE patternPS0002705275IPR017970Homeobox, conserved site
PROSITE profilePS5084841.535198435IPR002913START domain
SuperFamilySSF559612.34E-27198433No hitNo description
CDDcd088751.95E-98202431No hitNo description
SMARTSM002341.3E-33207432IPR002913START domain
PfamPF018522.5E-38208432IPR002913START domain
SuperFamilySSF559614.76E-15452691No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MDSGDEHEPE GSNNKNQHQR KQYHRHTPHQ IQRLEAMFKE CPHPDENQRA ALARELDLEP  60
QQIKFWFQNR RTQMKAQHER ASNSFLRMEN DKIRCENITM RGALKNAICP SCVGQPVTDY  120
FDEQNLRMEN TQLKQELDRM SSITSKYLGR PFTQALPTSV PALDLSVGGV PGPGLGGGPS  180
LDLDLLSGCS SAMLPPVTEM ERPMMADLAA RAMDELIRLA QAGRQLWDKG VPGGAPETLN  240
VAAYDSLFAA PGGAFRPPDI GVEGSRDSGL VFMSAVALVD VFMDTNKWKE FFPGIVSKAH  300
TGDVLMSGLG GRSESLVMMY EQLHMVAPVV PTREFSFLRY CKQIEPGLWA VADVSPDALR  360
DVPYGMPPRS RRLPSGCLIA DMSNGYSNVT WVEHMEIEQT LPISALYRNL VLSGAAFGAH  420
RWLAALQRAC ERVGSLAMLG APLHDLVGAG VTPEGKRSTM KLSQQMVSLF CASLSSSPQQ  480
RWVLLPGTTD VSVRVATQPS VEPGQPNSVV LTAATSIWLP VPASHAFAFL RDENARSQWD  540
ILAHANQVQE VLRIPNGSNP DNCVSVLRGM TNANQDGMLI LQESCTDASG SSLVVYSPID  600
LLTANVVMSG EDASSIPMLP SGFVILPDAR PGTGAAGGSS SSSGGALAAI SLSCVVTVAF  660
QILVSSLPSA RVDAESMATV TGLIGTTVQQ IKAALNCAGP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438026.10.0hypothetical protein SORBIDRAFT_10g006820
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLC5Z6D60.0C5Z6D6_SORBI; Putative uncharacterized protein Sb10g006820
STRINGSb10g006820.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11